Structure of PDB 7y3i Chain B Binding Site BS03

Receptor Information
>7y3i Chain B (length=53) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QHGCTRCGKNFSSASALQIHERTHTGEKPFVCNICGRAFTTKGNLKVHYM
THG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7y3i Structural studies of SALL family protein zinc finger cluster domains in complex with DNA reveal preferential binding to an AATA tetranucleotide motif.
Resolution2.45 Å
Binding residue
(original residue number in PDB)
N901 K910 K914 Y917
Binding residue
(residue number reindexed from 1)
N33 K42 K46 Y49
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:7y3i, PDBe:7y3i, PDBj:7y3i
PDBsum7y3i
PubMed36257403
UniProtQ9UJQ4|SALL4_HUMAN Sal-like protein 4 (Gene Name=SALL4)

[Back to BioLiP]