Structure of PDB 7wmc Chain B Binding Site BS03

Receptor Information

>7wmc Chain B (length=230) Species: 9606 (Homo sapiens)

GFTSKDTYLSHFNPRDYLEKYYKFGSRHSAESQILKHLLKNLFKIFCLDG
VKGDLLIDIGSGPTIYQLLSACESFKEIVVTDYSDQNLQELEKWLKKEPA
AFDWSPVVTYVCDLEGNRVKGPEKEEKLRQAVKQVLKCDVTQSQPLGAVP
LPPADCVLSTLCLDAACPDLPTYCRALRNLGSLLKPGGFLVIMDALLGRE
AVEAAVKEAGYTIEWFEVIEGLFSLVARKL

Ligand information

>7wmc Chain D (length=9) Species: 32644 (unidentified)

GFFRGKWPC

Receptor-Ligand Complex Structure

Structure summary

• PDB: 7wmc Peptide-to-Small Molecule: A Pharmacophore-Guided Small Molecule Lead Generation Strategy from High-Affinity Macrocyclic Peptides.
• Resolution: 2.55 Å
• Binding residue (original residue number in PDB): F5 D9 T10 Y11 G63 S64 G65 T67 D85 Y86 N90 D142 V143 T163 C165 A168 A169 Y176
• Binding residue (residue number reindexed from 1): F2 D6 T7 Y8 G60 S61 G62 T64 D82 Y83 N87 D139 V140 T160 C162 A165 A166 Y173

Enzymatic activity

• Enzyme Commision number: 2.1.1.1: nicotinamide N-methyltransferase.

Gene Ontology

Molecular Function

• GO:0008112 nicotinamide N-methyltransferase activity
• GO:0008168 methyltransferase activity
• GO:0030760 pyridine N-methyltransferase activity

Biological Process

• GO:0006769 nicotinamide metabolic process
• GO:0009410 response to xenobiotic stimulus
• GO:0031100 animal organ regeneration
• GO:0032259 methylation
• GO:0034356 NAD biosynthesis via nicotinamide riboside salvage pathway
• GO:0045722 positive regulation of gluconeogenesis
• GO:0090312 positive regulation of protein deacetylation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol

External links

• PDB: RCSB:7wmc, PDBe:7wmc, PDBj:7wmc
• PDBsum: 7wmc
• PubMed: 35904556
• UniProt: P40261|NNMT_HUMAN Nicotinamide N-methyltransferase (Gene Name=NNMT)