Structure of PDB 7svw Chain B Binding Site BS03

Receptor Information
>7svw Chain B (length=446) Species: 1469607 ([Scytonema hofmanni] UTEX 2349) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LEKNVIATQLSEEAQVKLEVIQSLLEPCDRTTYGQKLREAAEKLNVSLRT
VQRLVKNWEQDGLVGLTQTSRADKGKHRIGEFWENFITKTYKEGNKGSKR
MTPKQVALRVEAKARELKDSKPPNYKTVLRVLAPILEKQQKAKSIRSPGW
RGTTLSVKTREGKDLSVDYSNHVWQCDHTRVDVLLVDQHGEILSRPWLTT
VIDTYSRCIMGINLGFDAPSSGVVALALRHAILPKRYGSEYKLHCEWGTY
GKPEHFYTDGGKDFRSNHLSQIGAQLGFVCHLRDRPSEGGVVERPFKTLN
DQLFSTLPGYTGSNVQERPEDAEKDARLTLRELEQLLVRYIVDRYNQSID
ARMGDQTRFERWEAGLPTVPVPIPERDLDICLMKQSRRTVQRGGCLQFQN
LMYRGEYLAGYAGETVNLRFDPRDITTILVYRQENNQEVFLTRAHA
Ligand information
>7svw Chain 4 (length=50) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
caccgacgacagataatttgtcactgtacaggccctaggtctacggttag
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7svw Mechanistic details of CRISPR-associated transposon recruitment and integration revealed by cryo-EM.
Resolution3.69 Å
Binding residue
(original residue number in PDB)		R58 G62 R77 K84 R99 K102 G103 H105 R106 N152 K154 T155 R158 A246 S248 K290 S294 N295
Binding residue
(residue number reindexed from 1)		R30 G34 R49 K56 R71 K74 G75 H77 R78 N124 K126 T127 R130 A218 S220 K262 S266 N267
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Sat Nov 16 13:26:30 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1435     title=pdb2title(pdbid)
   1436     if bs.startswith("BS"):
=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)
   1438     else:
   1439         if lig3:
pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '7svw', asym_id = 'B', bs = 'BS03', title = 'Mechanistic details of CRISPR-associated transposon recruitment and integration revealed by cryo-EM.'
 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='7svw', asym_id='B', bs='BS03', title='Mechanistic details of CRISPR-associated transposon recruitment and integration revealed by cryo-EM.')
   1295         display_ec(ec,csaOrig,csaRenu)
   1296     if go:
=> 1297         display_go(go,uniprot,pdbid,asym_id)
   1298     return pubmed,uniprot
   1299 
global display_go = <function display_go>, go = '0003676,0015074', uniprot = '', pdbid = '7svw', asym_id = 'B'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003676,0015074', uniprot='', pdbid='7svw', asym_id='B')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>