Structure of PDB 7lbw Chain B Binding Site BS03

Receptor Information
>7lbw Chain B (length=190) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SVLASCPKKPVSSYLRFSKEQLPIFKAQNPDAKTTELIRRIAQRWRELPD
SKKKIYQDAYRAEWQVYKEEISRFKEQLTPSQIMSLEKEIMDKHLKRKAM
TKKKELTLLGKPKRPRSAYNVYVAERFQEAKGDSPQEKLKTVKENWKNLS
DSEKELYIQHAKEDETRYHNEMKSWEEQMIEVGRKDLLRR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7lbw A minimal motif for sequence recognition by mitochondrial transcription factor A (TFAM).
Resolution2.84 Å
Binding residue
(original residue number in PDB)
K146 R157 Y162 Q179 K186 W189 K190 E208 Y211 R232
Binding residue
(residue number reindexed from 1)
K103 R114 Y119 Q136 K143 W146 K147 E165 Y168 R189
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:7lbw, PDBe:7lbw, PDBj:7lbw
PDBsum7lbw
PubMed34928349
UniProtQ00059|TFAM_HUMAN Transcription factor A, mitochondrial (Gene Name=TFAM)

[Back to BioLiP]