Structure of PDB 7ins Chain B Binding Site BS03

Receptor Information

>7ins Chain B (length=30) Species: 9823 (Sus scrofa) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

FVNQHLCGSHLVEALYLVCGERGFFYTPKA

Ligand information

>7ins Chain G (length=16) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ARRRGGGGGRKKGRRR

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7ins Structure of porcine insulin cocrystallized with clupeine Z.
Resolution	2.0 Å
Binding residue (original residue number in PDB)	V2 N3 Q4 H5 L6 S9 H10 E13 Y16 L17 G20 T27 K29 A30
Binding residue (residue number reindexed from 1)	V2 N3 Q4 H5 L6 S9 H10 E13 Y16 L17 G20 T27 K29 A30

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0005179	hormone activity

	Cellular Component
GO:0005576	extracellular region

View graph for
Molecular Function

View graph for
Cellular Component

External links

PDB	RCSB:7ins, PDBe:7ins, PDBj:7ins
PDBsum	7ins
PubMed	1772633
UniProt	P01315\|INS_PIG Insulin (Gene Name=INS)

[Back to BioLiP]