Structure of PDB 7dw5 Chain B Binding Site BS03

Receptor Information
>7dw5 Chain B (length=131) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RRRRLVWTPSQSEALRACFERNPYPGIATRERLAQAIGIPEPRVQIWFQN
ERSRQLRQHRRESRPWPGRRGPPEGRRKRTAVTGSQTALLLRAFEKDRFP
GIAAREELARETGLPESRIQIWFQNRRARHP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7dw5 DNA crosslinking and recombination-activating genes 1/2 (RAG1/2) are required for oncogenic splicing in acute lymphoblastic leukemia.
Resolution2.83 Å
Binding residue
(original residue number in PDB)
R23 Y43 Q68
Binding residue
(residue number reindexed from 1)
R4 Y24 Q49
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:7dw5, PDBe:7dw5, PDBj:7dw5
PDBsum7dw5
PubMed34699692
UniProtP0CJ85|DU4L2_HUMAN Double homeobox protein 4-like protein 2 (Gene Name=DUX4L2)

[Back to BioLiP]