Structure of PDB 6s16 Chain B Binding Site BS03

Receptor Information
>6s16 Chain B (length=165) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HMVVAGIDPGITHLGLGVVAVKGALKARLLHGEVVKTSPQEPAKERVGRI
HARVLEVLHRFRPEAVAVEEQFFYRQNELAYKVGWALGAVLVAAFEAGVP
VYAYGPMQVKQALAGHGHAAKEEVALMVRGILGLKEAPRPSHLADALAIA
LTHAFYARMGTAKPL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6s16 RuvC uses dynamic probing of the Holliday junction to achieve sequence specificity and efficient resolution.
Resolution3.409 Å
Binding residue
(original residue number in PDB)		G9 I10 T11 P40 R47 Q72 F74 R76 L80 V84
Binding residue
(residue number reindexed from 1)		G10 I11 T12 P39 R46 Q71 F73 R75 L79 V83
Enzymatic activity
Enzyme Commision number 3.1.21.10: crossover junction endodeoxyribonuclease.
Gene Ontology
Molecular Function
GO:0000287 magnesium ion binding
GO:0003676 nucleic acid binding
GO:0003677 DNA binding
GO:0004519 endonuclease activity
GO:0004520 DNA endonuclease activity
GO:0008821 crossover junction DNA endonuclease activity
GO:0046872 metal ion binding
Biological Process
GO:0006281 DNA repair
GO:0006310 DNA recombination
Cellular Component
GO:0005737 cytoplasm
GO:0048476 Holliday junction resolvase complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6s16, PDBe:6s16, PDBj:6s16
PDBsum6s16
PubMed31506434
UniProtQ5SJC4|RUVC_THET8 Crossover junction endodeoxyribonuclease RuvC (Gene Name=ruvC)

[Back to BioLiP]