Structure of PDB 6iit Chain B Binding Site BS03

Receptor Information
>6iit Chain B (length=100) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SMARPRPREYKAGDLVFAKMKGYPHWPARIDELPEGAVKPPANKYPIFFF
GTHETAFLGPKDLFPYKEYKDKFGKSNKRKGFNEGLWEIENNPGVKFTGY
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6iit Complex structure of the HRP3 PWWP domain with both a 16-bp TA-rich DNA and a H3K36me2-containing histone peptide
Resolution2.1 Å
Binding residue
(original residue number in PDB)
M19 K20 Y22 W25 F48 T51 E53 T54
Binding residue
(residue number reindexed from 1)
M20 K21 Y23 W26 F49 T52 E54 T55
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6iit, PDBe:6iit, PDBj:6iit
PDBsum6iit
PubMed
UniProtQ9Y3E1|HDGR3_HUMAN Hepatoma-derived growth factor-related protein 3 (Gene Name=HDGFL3)

[Back to BioLiP]