Structure of PDB 6az3 Chain B Binding Site BS03

Receptor Information
>6az3 Chain B (length=402) Species: 5661 (Leishmania donovani) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SHCKFEHPRHGHLGFLPRKRSRQIRGRARAFPKDDATQKPHLTSFMVFKA
GMTHIVRDVDRPGSKVNKKEVVEPVTILEAPPMVIVGIVGYRQTPVGLKT
IGTVWAHHTSVEFRRRYYKNWKQSAQLAFSRQKQFANTKEGKVAEARTLN
AFAKKASVIRVIAHTQLRKLRNHRVGVKKAHVQEIQINGGNVAAKIALAK
SLLEKEVRVDSVFQQSEACDVCSVTKGHGTEGVVKRWGVACLPRKTHRGL
RKVACIGAWHPARVMYTVARAGQHGYHHRTQLNKKIYQIGRSVAVEPNQA
TTTYDLTAKTITPMGGFVGYGTVRNDYVMLKGSVSGPRRRVMTLRRPMAP
QTSRHLKEKIVLKFIDTSSKIGHGRFQTKKEKNQWFGPLKKDRIRREERL
RK
Ligand information
>6az3 Chain 4 (length=183) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gugagauugugaagggaucucgcagguaucgugagggaaguaugggguag
uacgagaggaacucccaugccgugccucuaguuucugggguuugucgaac
ggcaagugccccgaagccaucgcacggugguucucggcugaacgccucua
agccagaagccaaucccaagaccagaugcccac
<<<<<<<.........>>>>>>>.<<<<<<....<<<<.<<<<<<<<...
............>>>>>>>><<<<<...<.<<....<<<<<<<<<.....
.>>>>..>>>>>...>>.>..>>>>>.<<<<....<<<<...........
>>>>....>>>>.>>>>.......>>>>>>...
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6az3 Atomic resolution snapshot of Leishmania ribosome inhibition by the aminoglycoside paromomycin.
Resolution2.5 Å
Binding residue
(original residue number in PDB)		H11 G12 H13 L14 G15 F16 P18 R19 K20 R26 R30 A31 K50 M53 T54 H55 R62 S65 P75 Y92 L99 T101 G103 T104 W106 Y118 K120 L128 A129 F130 R132 Q133 R161 E185 K227 H229 Y267 H279 R280 T281 L283 N284 K285 K332 S334 V335 S336 G337 M349 P351 R355 K371 G373 H374
Binding residue
(residue number reindexed from 1)		H10 G11 H12 L13 G14 F15 P17 R18 K19 R25 R29 A30 K49 M52 T53 H54 R61 S64 P74 Y91 L98 T100 G102 T103 W105 Y117 K119 L127 A128 F129 R131 Q132 R160 E184 K226 H228 Y266 H278 R279 T280 L282 N283 K284 K331 S333 V334 S335 G336 M348 P350 R354 K370 G372 H373
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Sat Nov 16 04:45:49 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1435     title=pdb2title(pdbid)
   1436     if bs.startswith("BS"):
=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)
   1438     else:
   1439         if lig3:
pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '6az3', asym_id = 'B', bs = 'BS03', title = 'Atomic resolution snapshot of Leishmania ribosome inhibition by the aminoglycoside paromomycin.'
 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='6az3', asym_id='B', bs='BS03', title='Atomic resolution snapshot of Leishmania ribosome inhibition by the aminoglycoside paromomycin.')
   1295         display_ec(ec,csaOrig,csaRenu)
   1296     if go:
=> 1297         display_go(go,uniprot,pdbid,asym_id)
   1298     return pubmed,uniprot
   1299 
global display_go = <function display_go>, go = '0003735,0005840,0006412', uniprot = '', pdbid = '6az3', asym_id = 'B'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412', uniprot='', pdbid='6az3', asym_id='B')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>