Structure of PDB 5uqa Chain B Binding Site BS03

Receptor Information
>5uqa Chain B (length=30) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FVNQHLCGSHLVEALYLVCGERGFFYTPKT
Ligand information
>5uqa Chain I (length=21) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GIVEQCCTSICSLYQLENYCN
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5uqa Insulin with proline analog FzP at position B28 in the R6 state
Resolution1.31 Å
Binding residue
(original residue number in PDB)
V2 H5
Binding residue
(residue number reindexed from 1)
V2 H5
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005179 hormone activity
Cellular Component
GO:0005576 extracellular region

View graph for
Molecular Function

View graph for
Cellular Component
External links
PDB RCSB:5uqa, PDBe:5uqa, PDBj:5uqa
PDBsum5uqa
PubMed
UniProtP01308|INS_HUMAN Insulin (Gene Name=INS)

[Back to BioLiP]