Structure of PDB 5o63 Chain B Binding Site BS03

Receptor Information
>5o63 Chain B (length=161) Species: 32644 (unidentified) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MNELIKYAKELVRSAGKTLKSAAMFAKVLTPNDDSGRHGVLVPTEAYSFF
PDMPISDPSQNATSNFPAFDSLSKTHKTLAYKYYERYPERRITRMHGLLN
ERNYDPRLTIFLFARHTDGSSGYYFDCANSGSGGRFEVLFALCFGEAISP
KAGLFVVRPID
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5o63 UbaLAI is a monomeric Type IIE restriction enzyme.
Resolution1.6 Å
Binding residue
(original residue number in PDB)		T30 P31 N32 R37 H38 L41 P43 T44 Y87 E89 G153
Binding residue
(residue number reindexed from 1)		T30 P31 N32 R37 H38 L41 P43 T44 Y87 E89 G153
External links