Structure of PDB 5eea Chain B Binding Site BS03

Receptor Information
>5eea Chain B (length=61) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RKKRIPYSKGQLRELEREYAANKFITKDKRRKISAATSLSERQITIWFQN
RRVKEKKVLAK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5eea Two distinct DNA sequences recognized by transcription factors represent enthalpy and entropy optima.
Resolution2.195 Å
Binding residue
(original residue number in PDB)		K225 G226
Binding residue
(residue number reindexed from 1)		K9 G10
Binding affinityPDBbind-CN: Kd=41nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677 DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:5eea, PDBe:5eea, PDBj:5eea
PDBsum5eea
PubMed29638214
UniProtQ92826|HXB13_HUMAN Homeobox protein Hox-B13 (Gene Name=HOXB13)

[Back to BioLiP]