Structure of PDB 4l5s Chain B Binding Site BS03

Receptor Information
>4l5s Chain B (length=198) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TPKKNISKGAVLHEKPMTVMVLTATEPFNYKEGKENMFHATVATESKYYR
VKVFNMDLKEKFTENQFITISKYFNSSGILEINETATVSEAAPNQMFEVP
KNIIRSAKETLKISKIKELDSGTLIYGVFAVEKKKVNDKSITFKIKDNED
NIKVVWDKEQHNINYEKGDKLQLFSFHLRKGNGKPILHSGNHSFIKGE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4l5s Molecular Mechanism for p202-Mediated Specific Inhibition of AIM2 Inflammasome Activation.
Resolution2.94 Å
Binding residue
(original residue number in PDB)		S166 H222 R224 G226 N227 N236
Binding residue
(residue number reindexed from 1)		S121 H177 R179 G181 N182 N191
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0002218 activation of innate immune response
GO:0035458 cellular response to interferon-beta

View graph for
Biological Process
External links
PDB RCSB:4l5s, PDBe:4l5s, PDBj:4l5s
PDBsum4l5s
PubMed23850291
UniProtQ9R002|IFI2_MOUSE Interferon-activable protein 202 (Gene Name=Ifi202)

[Back to BioLiP]