Structure of PDB 4b5m Chain B Binding Site BS03

Receptor Information
>4b5m Chain B (length=259) Species: 487 (Neisseria meningitidis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MLKIISANVNGIRSAYKKGFYEYIAASGADIVCVQELKAQEADLSADMKN
PHGMHGHWHCAEKRGYSGVAVYSKRKPDNVQIGMGIEEFDREGRFVRCDF
GRLSVISLYLPSGSSAEERQQVKYRFLDAFYPMLEAMKNEGRDIVVCGDW
NIAHQNIDLKNWKGNQKNSGFLPEEREWIGKVIHKLGWTDMWRTLYPDVP
GYTWWSNRGQAYAKDVGWRIDYQMVTPELAAKAVSAHVYKDEKFSDHAPL
VVEYDYAAE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4b5m Structural basis for the recognition and cleavage of abasic DNA in Neisseria meningitidis.
Resolution2.758 Å
Binding residue
(original residue number in PDB)		N10 G11 R13 S14 K38 R64 K167 R208
Binding residue
(residue number reindexed from 1)		N10 G11 R13 S14 K38 R64 K167 R208
Enzymatic activity
Catalytic site (original residue number in PDB) N8 N10 E36 Y109 D149 N151 D221 D246 H247
Catalytic site (residue number reindexed from 1) N8 N10 E36 Y109 D149 N151 D221 D246 H247
Enzyme Commision number 3.1.11.2: exodeoxyribonuclease III.
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003824 catalytic activity
GO:0003906 DNA-(apurinic or apyrimidinic site) endonuclease activity
GO:0004518 nuclease activity
GO:0004519 endonuclease activity
GO:0008081 phosphoric diester hydrolase activity
GO:0008311 double-stranded DNA 3'-5' DNA exonuclease activity
GO:0016787 hydrolase activity
GO:0046872 metal ion binding
Biological Process
GO:0006281 DNA repair
GO:0006284 base-excision repair

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4b5m, PDBe:4b5m, PDBj:4b5m
PDBsum4b5m
PubMed23035246
UniProtQ7DD47

[Back to BioLiP]