Structure of PDB 4anj Chain B Binding Site BS03

Receptor Information
>4anj Chain B (length=128) Species: 7227 (Drosophila melanogaster) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TEEQIAEFKEAFSLFDKDGDGTELGTVMRSLGQNPTEAELQDMINEVDAD
GNGTIDFPEFLTMMARKDSEEEIREAFRVFDKDGNGFISAAELRHVMTTD
EEVDEMIREADIDGDGQVNYEEFVTMMT
Ligand information
Ligand IDCA
InChIInChI=1S/Ca/q+2
InChIKeyBHPQYMZQTOCNFJ-UHFFFAOYSA-N
SMILES
SoftwareSMILES
CACTVS 3.341[Ca++]
ACDLabs 10.04
OpenEye OEToolkits 1.5.0
[Ca+2]
FormulaCa
NameCALCIUM ION
ChEMBL
DrugBankDB14577
ZINC
PDB chain4anj Chain B Residue 1149 [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4anj Processive Steps in the Reverse Direction Require Uncoupling of the Lead Head Lever Arm of Myosin Vi.
Resolution2.6 Å
Binding residue
(original residue number in PDB)
D129 D131 Q135 N137 E140
Binding residue
(residue number reindexed from 1)
D111 D113 Q117 N119 E122
Annotation score4
Enzymatic activity
Catalytic site (original residue number in PDB) V35
Catalytic site (residue number reindexed from 1) V27
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005509 calcium ion binding
GO:0005515 protein binding
GO:0016247 channel regulator activity
GO:0030234 enzyme regulator activity
GO:0031489 myosin V binding
GO:0032036 myosin heavy chain binding
GO:0046872 metal ion binding
GO:0070855 myosin VI head/neck binding
Biological Process
GO:0007099 centriole replication
GO:0007605 sensory perception of sound
GO:0007608 sensory perception of smell
GO:0016056 G protein-coupled opsin signaling pathway
GO:0016059 negative regulation of opsin-mediated signaling pathway
GO:0016060 negative regulation of phospholipase C-activating phototransduction signaling pathway
GO:0030048 actin filament-based movement
GO:0042052 rhabdomere development
GO:0046716 muscle cell cellular homeostasis
GO:0048102 autophagic cell death
GO:0050911 detection of chemical stimulus involved in sensory perception of smell
GO:0051383 kinetochore organization
GO:0071361 cellular response to ethanol
GO:0072499 photoreceptor cell axon guidance
Cellular Component
GO:0005654 nucleoplasm
GO:0005737 cytoplasm
GO:0005813 centrosome
GO:0005814 centriole
GO:0005819 spindle
GO:0005829 cytosol
GO:0005886 plasma membrane
GO:0005938 cell cortex
GO:0016028 rhabdomere
GO:0030496 midbody
GO:0031475 myosin V complex
GO:0031476 myosin VI complex
GO:0031477 myosin VII complex
GO:0072686 mitotic spindle
GO:0097431 mitotic spindle pole

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:4anj, PDBe:4anj, PDBj:4anj
PDBsum4anj
PubMed22940248
UniProtP62152|CALM_DROME Calmodulin (Gene Name=Cam)

[Back to BioLiP]