Structure of PDB 3e44 Chain B Binding Site BS03

Receptor Information

>3e44 Chain B (length=241) Species: 727 (Haemophilus influenzae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

SFIKPIYQDINSILIGQKVPFEKLVYKFLKENLSDLTFKQYEYLNDLFMK
NPAIIGHEARYKLFNSPTLLFLLSRGKAATENWSIENLFEEKQNDTADIL
LVKDQFYELLDVKTRNISKSAFAPNIISAYKLAQTCAKMIDNKEFDLFDI
NYLEVDWELNGEDLVCVSTSFAELFKSEPSELYINWAAAMQIQFHVRDLD
QGFNGTREEWAKSYLKHFVTQAEQRAISMIDKFVKPFKKYI

Ligand information

>3e44 Chain G (length=7) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

gccggtt

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	3e44 DNA distortion and specificity in a sequence-specific endonuclease.
Resolution	2.52 Å
Binding residue (original residue number in PDB)	F138 Y199 N201 A203 A204 R241
Binding residue (residue number reindexed from 1)	F122 Y183 N185 A187 A188 R225

Enzymatic activity

Enzyme Commision number

3.1.21.4: type II site-specific deoxyribonuclease.

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0004519	endonuclease activity
GO:0009036	type II site-specific deoxyribonuclease activity

	Biological Process
GO:0009307	DNA restriction-modification system

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:3e44, PDBe:3e44, PDBj:3e44
PDBsum	3e44
PubMed	18762194
UniProt	P17743\|T2C2_HAEIF Type II restriction enzyme HincII (Gene Name=hincIIR)

[Back to BioLiP]