Structure of PDB 2vbn Chain B Binding Site BS03

Receptor Information
>2vbn Chain B (length=152) Species: 3055 (Chlamydomonas reinhardtii) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NTKYNKEFLLYLAGFVDGDGSIIAQIEPNQSYKFKHRLKLTFKVTQKTQR
RWFLDKLVDEIGVGYVSDSGSVSNYILSEIKPLHNFLTQLQPFLKLKQKQ
ANLVLKIIEQLPSAKESPDKFLEVCTWVDQIAALNDSKTRKTTSETVRAV
LD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2vbn Molecular Basis of Xeroderma Pigmentosum Group C DNA Recognition by Engineered Meganucleases
Resolution1.9 Å
Binding residue
(original residue number in PDB)		G19 D20 S22 I24 Q26 E28 N136 D137 S138 T140 R141 K142
Binding residue
(residue number reindexed from 1)		G18 D19 S21 I23 Q25 E27 N135 D136 S137 T139 R140 K141
Enzymatic activity
Catalytic site (original residue number in PDB) G19 D20
Catalytic site (residue number reindexed from 1) G18 D19
Enzyme Commision number 3.1.-.-
Gene Ontology
Molecular Function
GO:0004519 endonuclease activity
GO:0042802 identical protein binding
GO:0046872 metal ion binding
Biological Process
GO:0006314 intron homing
Cellular Component
GO:0009507 chloroplast

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2vbn, PDBe:2vbn, PDBj:2vbn
PDBsum2vbn
PubMed18987743
UniProtP05725|DNE1_CHLRE DNA endonuclease I-CreI

[Back to BioLiP]