Structure of PDB 2cb8 Chain B Binding Site BS03

Receptor Information

>2cb8 Chain B (length=85) Species: 9606 (Homo sapiens)

QAEFEKAAEEVRHLKTKPSDEEMLFIYGHYKQATVGDINTERPGMLDFTG
KAKWDAWNELKGTSKEDAMKAYINKVEELKKKYGI

Ligand information

• Ligand ID: ZN
• InChI: InChI=1S/Zn/q+2
• InChIKey: PTFCDOFLOPIGGS-UHFFFAOYSA-N
• SMILES:
  CACTVS 3.341: [Zn++]
  ACDLabs 10.04
  OpenEye OEToolkits 1.5.0: [Zn+2]
• Formula: Zn
• Name: ZINC ION
• ChEMBL: CHEMBL1236970
• DrugBank: DB14532
• PDB chain: 2cb8 Chain B Residue 1090

Receptor-Ligand Complex Structure

Structure summary

• PDB: 2cb8 High Resolution Crystal Structures of Unliganded and Liganded Human Liver Acbp Reveal a New Mode of Binding for the Acyl-Coa Ligand.
• Resolution: 1.4 Å
• Binding residue (original residue number in PDB): E11 H15
• Binding residue (residue number reindexed from 1): E9 H13
• Annotation score: 4

Gene Ontology

Molecular Function

• GO:0000062 fatty-acyl-CoA binding
• GO:0008289 lipid binding
• GO:0030156 benzodiazepine receptor binding
• GO:0036042 long-chain fatty acyl-CoA binding
• GO:0042802 identical protein binding

Biological Process

• GO:0006631 fatty acid metabolic process
• GO:0036151 phosphatidylcholine acyl-chain remodeling
• GO:1903060 negative regulation of protein lipidation
• GO:1905920 positive regulation of CoA-transferase activity
• GO:2001140 positive regulation of phospholipid transport

Cellular Component

• GO:0005783 endoplasmic reticulum
• GO:0005788 endoplasmic reticulum lumen
• GO:0005794 Golgi apparatus
• GO:0032994 protein-lipid complex
• GO:0070062 extracellular exosome

External links

• PDB: RCSB:2cb8, PDBe:2cb8, PDBj:2cb8
• PDBsum: 2cb8
• PubMed: 17044054
• UniProt: P07108|ACBP_HUMAN Acyl-CoA-binding protein (Gene Name=DBI)