Structure of PDB 1zr2 Chain B Binding Site BS03

Receptor Information

>1zr2 Chain B (length=182) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

ALFGYARVSTSQQSLDIQVRALKDAGVKANRIFTDKASGSSSDRKGLDLL
RMKVKEGDVILVKKLDRLGRDTADMIQLIKEFDAQGVSIRFIDDGISTDS
YIGKMVVTILSAVAQAERQRILQRTNEGRQEAMAKGVVFGRKRKIDRDAV
LNMWQQGLGASHISKTMNIARSTVYKVINESN

Ligand information

>1zr2 Chain K (length=13) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ttatcggacactg

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1zr2 Structure of a synaptic gamma delta resolvase tetramer covalently linked to two cleaved DNAs.
Resolution	3.9 Å
Binding residue (original residue number in PDB)	G141 R142 R144 I170 A171 S173 T174
Binding residue (residue number reindexed from 1)	G140 R141 R143 I169 A170 S172 T173

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0000150	DNA strand exchange activity
GO:0003677	DNA binding

	Biological Process
GO:0006310	DNA recombination
GO:0015074	DNA integration

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:1zr2, PDBe:1zr2, PDBj:1zr2
PDBsum	1zr2
PubMed	15994378
UniProt	P03012\|TNR1_ECOLI Transposon gamma-delta resolvase (Gene Name=tnpR)

[Back to BioLiP]