Structure of PDB 1mhw Chain B Binding Site BS03

Receptor Information
>1mhw Chain B (length=174) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
APRSVDWREKGYVTPVKNQGQCGSCWAFSATGALEGQMFRKTGRLISLSE
QNLVDCSGPQGNEGCNGGLMDYAFQYVQDNGGLDSEESYPYEATEESCKY
NPKYSVANDTGFVDIPKQEKALMKAVATVGPISVAIDAGHESFLFYKEGI
YFEPDCSSEDMDHGVLVVGYGFES
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1mhw Design of non-covalent inhibitors of human cathepsin L. From the 96-residue proregion to optimized tripeptides
Resolution1.9 Å
Binding residue
(original residue number in PDB)		Q19 Q21 C22 A25 G61 E63 G67 G68 L69 M70 A135 D162 H163
Binding residue
(residue number reindexed from 1)		Q19 Q21 C22 A25 G61 E63 G67 G68 L69 M70 A135 D162 H163
Enzymatic activity
Enzyme Commision number 3.4.22.15: cathepsin L.
Gene Ontology
Molecular Function
GO:0008234 cysteine-type peptidase activity
Biological Process
GO:0006508 proteolysis

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1mhw, PDBe:1mhw, PDBj:1mhw
PDBsum1mhw
PubMed12431059
UniProtP07711|CATL1_HUMAN Procathepsin L (Gene Name=CTSL)

[Back to BioLiP]