Structure of PDB 1fiu Chain B Binding Site BS03

Receptor Information

>1fiu Chain B (length=286) Species: 485 (Neisseria gonorrhoeae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

MQPLFTQERRIFHKKLLDGNILATNNRGVVSNADGSNTRSFNIAKGIADL
LHSETVSERLPGQTSGNAFEAICSEFVQSAFEKLQHIRPGDWNVKQVGSR
NRLEIARYQQYAHLTALAKAAEENPELAAALGSDYTITPDIIVTRNLIAD
AEINRNEFLVDENIATYASLRAGNGNMPLLHASISCKWTIRSDRAQNARS
EGLNLVRNRKGRLPHIVVVTAEPTPSRISSIALGTGEIDCVYHFALYELE
QILQSLNYEDALDLFYIMVNGKRLKDISDLPLDLAV

Ligand information

>1fiu Chain J (length=7) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ccggcgc

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1fiu Structure of the tetrameric restriction endonuclease NgoMIV in complex with cleaved DNA.
Resolution	1.6 Å
Binding residue (original residue number in PDB)	Q63 T64 N67 D193
Binding residue (residue number reindexed from 1)	Q63 T64 N67 D193

Enzymatic activity

Enzyme Commision number

3.1.21.4: type II site-specific deoxyribonuclease.

Gene Ontology

	Molecular Function
GO:0004519	endonuclease activity
GO:0009036	type II site-specific deoxyribonuclease activity
GO:0046872	metal ion binding

	Biological Process
GO:0009307	DNA restriction-modification system

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:1fiu, PDBe:1fiu, PDBj:1fiu
PDBsum	1fiu
PubMed	10966652
UniProt	P31032\|T2M4_NEIGO Type II restriction enzyme NgoMIV (Gene Name=ngoMIVR)

[Back to BioLiP]