Structure of PDB 1cqt Chain B Binding Site BS03

Receptor Information
>1cqt Chain B (length=129) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DLEELEQFAKTFKQRRIKLGFTQGDVGLAMGKLYNDFSQTTISRFEALNL
SFKNMCKLKPLLEKWLNDAERKKRTSIETNIRVALEKSFLENQKTSEEIT
MIADQLNMEKEVIRVWFCNRRQKEKRINP
Ligand information
>1cqt Chain J (length=23) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ARPYQGVRVKEPVKELLRRKRGH
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1cqt Crystal structure of an OCA-B peptide bound to an Oct-1 POU domain/octamer DNA complex: specific recognition of a protein-DNA interface.
Resolution3.2 Å
Binding residue
(original residue number in PDB)		E510 L553 N554 L555 S556 M560 K655 R658 I659
Binding residue
(residue number reindexed from 1)		E6 L48 N49 L50 S51 M55 K123 R126 I127
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1cqt, PDBe:1cqt, PDBj:1cqt
PDBsum1cqt
PubMed10541551
UniProtP14859|PO2F1_HUMAN POU domain, class 2, transcription factor 1 (Gene Name=POU2F1)

[Back to BioLiP]