Structure of PDB 6hiv Chain Ap Binding Site BS03

Receptor Information

>6hiv Chain Ap (length=261) Species: 5702 (Trypanosoma brucei brucei) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

NLKGLVYPLPYYAMWRGNHNKYTYNKSTVCLWGEGDTRSMYHQHYAHAKC
PTDYGRGGREFEYLTVKRGKMLQKPLPRVQYVAEGSKPVWLFKSWHTPLS
SPSMWEREVQYAEHTPEHIGAKRPLAVVAPRTMHRYLFLMHMEKVTITVS
PLLFGYGHTIQKAVLDFYRRAISARSPFPKDKVFLFYAIDHITPRIEVTW
LDGTSYVPPVLEGASSQDLIQMVMEEAWLAADRMAAEGRVLNPLAIDDYK
WDQLVVFKKVR

Ligand information

>6hiv Chain UM (length=6) Species: 5702 (Trypanosoma brucei brucei) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

PPPPPP

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6hiv Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.
Resolution	7.8 Å
Binding residue (original residue number in PDB)	K123 V125 W126 L127 F128
Binding residue (residue number reindexed from 1)	K87 V89 W90 L91 F92

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Cellular Component
GO:0005739	mitochondrion
GO:0005762	mitochondrial large ribosomal subunit

View graph for
Cellular Component

External links

PDB	RCSB:6hiv, PDBe:6hiv, PDBj:6hiv
PDBsum	6hiv
PubMed	30213880
UniProt	Q57YA9

[Back to BioLiP]