Structure of PDB 8a22 Chain Ah Binding Site BS03

Receptor Information
>8a22 Chain Ah (length=186) Species: 353565 (Polytomella magna) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MQPILNHTFPRNVQLRALKELKNIDLNGLRMRFVDAKGVGLGSLAMKVAT
ILQGKDKPTYSPYRENGDVVVVVNAAHIYLSQDKWETMKYWWHTGYAGGA
RELTAKQMWEKDPCQIIVRAVNGMLPKNVTRIQRMEKLKVFAEDEHPFKD
FPLTPLVIEQRKGFGWAPPEGFKPLNPERFDLRRRI
Ligand information
>8a22 Chain A5 (length=136) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
uaaugugcaccaaacaaccaggaggugggcuuggaagcagccauccuuug
aagaaagcguaauagcucugcuuuuuguguaacauuacacuacacgcaga
aaauaaaagccgaagcucgcuuguucaguuaaauau
<<<<<<<<<<.....<<.....<<...<<<<.......>>>>...>>...
.....<<<......>>>......>>.>>>>.>>>>>>.............
....................................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8a22 Structure of a mitochondrial ribosome with fragmented rRNA in complex with membrane-targeting elements.
Resolution2.91 Å
Binding residue
(original residue number in PDB)		G65 S104 Q105 K107 W114 H116 M147 K189 I213
Binding residue
(residue number reindexed from 1)		G42 S81 Q82 K84 W91 H93 M124 K162 I186
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Fri Nov 15 15:33:43 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1435     title=pdb2title(pdbid)
   1436     if bs.startswith("BS"):
=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)
   1438     else:
   1439         if lig3:
pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '8a22', asym_id = 'Ah', bs = 'BS03', title = 'Structure of a mitochondrial ribosome with fragm...rRNA in complex with membrane-targeting elements.'
 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='8a22', asym_id='Ah', bs='BS03', title='Structure of a mitochondrial ribosome with fragm...rRNA in complex with membrane-targeting elements.')
   1295         display_ec(ec,csaOrig,csaRenu)
   1296     if go:
=> 1297         display_go(go,uniprot,pdbid,asym_id)
   1298     return pubmed,uniprot
   1299 
global display_go = <function display_go>, go = '0003735,0005840,0006412', uniprot = '', pdbid = '8a22', asym_id = 'Ah'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412', uniprot='', pdbid='8a22', asym_id='Ah')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>