Structure of PDB 5mei Chain AP Binding Site BS03

Receptor Information

>5mei Chain AP (length=105) Species: 559292 (Saccharomyces cerevisiae S288C)

VNVPKTRKTYCKGKTCRKHTQHKVTQYKAGKASLFAQGKRRYDRKQSGFG
GQTKPVFHKKAKTTKKVVLRLECVKCKTRAQLTLKRCKHFELGGEKKQKG
QALQF

Ligand information

• Ligand ID: OHX
• InChI: InChI=1S/6H2N.Os/h6*1H2;/q6*-1;+6
• InChIKey: OWCQTVJQFLTQTE-UHFFFAOYSA-N
• SMILES:
  ACDLabs 12.01
  CACTVS 3.370
  OpenEye OEToolkits 1.7.0: N[Os](N)(N)(N)(N)N
• Formula: H12 N6 Os
• Name: osmium (III) hexammine;
  osmium(6+) hexaazanide
• PDB chain: 5mei Chain AP Residue 502

Receptor-Ligand Complex Structure

Structure summary

• PDB: 5mei Inhibition of Eukaryotic Translation by the Antitumor Natural Product Agelastatin A.
• Resolution: 3.5 Å
• Binding residue (original residue number in PDB): K46 S48 G49 F50
• Binding residue (residue number reindexed from 1): K45 S47 G48 F49
• Annotation score: 1

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0008270 zinc ion binding

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation
• GO:0046677 response to antibiotic
• GO:0046898 response to cycloheximide

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:0044391 ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:5mei, PDBe:5mei, PDBj:5mei
• PDBsum: 5mei
• PubMed: 28457705
• UniProt: P0CX27|RL44A_YEAST Large ribosomal subunit protein eL42A (Gene Name=RPL42A)