Structure of PDB 4v75 Chain AG Binding Site BS03

Receptor Information
>4v75 Chain AG (length=150) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RRRVIGQRKILPDPKFGSELLAKFVNILMVDGKKSTAESIVYSALETLAQ
RSGKSELEAFEVALENVRPTVEVKSRRVGGSTYQVPVEVRPVRRNALAMR
WIVEAARKRGDKSMALRLANELSDAAENKGTAVKKREDVHRMAEANKAFA
Ligand information
>4v75 Chain A3 (length=77) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cgcgggguggagcagccugguagcucgucgggcucauaacccgaaggucg
ucgguucaaauccggcccccgcaacca
...<<<<..<<<<.........>>>>.<<<<<.......>>>>>.....<
<<<<.......>>>>>>>>>.......
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4v75 Energy barriers and driving forces in tRNA translocation through the ribosome.
Resolution12.0 Å
Binding residue
(original residue number in PDB)		S76 R78 S82 T83 Q85 R142
Binding residue
(residue number reindexed from 1)		S75 R77 S81 T82 Q84 R141
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0015935 small ribosomal subunit

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v75, PDBe:4v75, PDBj:4v75
PDBsum4v75
PubMed24186064
UniProtP02359|RS7_ECOLI Small ribosomal subunit protein uS7 (Gene Name=rpsG)

[Back to BioLiP]