Structure of PDB 8acm Chain AAA Binding Site BS03

Receptor Information
>8acm Chain AAA (length=337) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGHRVAVK
KLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVY
LVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKP
SNLAVNEDCELKILDFGLTRWYRAPEIMLNWMHYNQTVDIWSVGCIMAEL
LTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLAQMP
KMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDD
EPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPL
Ligand information
Ligand IDMG
InChIInChI=1S/Mg/q+2
InChIKeyJLVVSXFLKOJNIY-UHFFFAOYSA-N
SMILES
SoftwareSMILES
ACDLabs 10.04
OpenEye OEToolkits 1.5.0		[Mg+2]
CACTVS 3.341[Mg++]
FormulaMg
NameMAGNESIUM ION
ChEMBL
DrugBankDB01378
ZINC
PDB chain8acm Chain AAA Residue 403 [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8acm Crystal structure of WT p38alpha
Resolution2.14 Å
Binding residue
(original residue number in PDB)		E192 Y200 N201 S293
Binding residue
(residue number reindexed from 1)		E176 Y184 N185 S277
Annotation score1
Enzymatic activity
Enzyme Commision number 2.7.11.24: mitogen-activated protein kinase.
Gene Ontology
Molecular Function
GO:0004672 protein kinase activity
GO:0004674 protein serine/threonine kinase activity
GO:0004707 MAP kinase activity
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0016301 kinase activity
GO:0019899 enzyme binding
GO:0019903 protein phosphatase binding
GO:0048273 mitogen-activated protein kinase p38 binding
GO:0051525 NFAT protein binding
GO:0106310 protein serine kinase activity
Biological Process
GO:0000077 DNA damage checkpoint signaling
GO:0000165 MAPK cascade
GO:0000902 cell morphogenesis
GO:0001502 cartilage condensation
GO:0001525 angiogenesis
GO:0001649 osteoblast differentiation
GO:0001890 placenta development
GO:0002021 response to dietary excess
GO:0002062 chondrocyte differentiation
GO:0006006 glucose metabolic process
GO:0006355 regulation of DNA-templated transcription
GO:0006357 regulation of transcription by RNA polymerase II
GO:0006366 transcription by RNA polymerase II
GO:0006468 protein phosphorylation
GO:0006915 apoptotic process
GO:0006974 DNA damage response
GO:0007178 cell surface receptor protein serine/threonine kinase signaling pathway
GO:0007519 skeletal muscle tissue development
GO:0010628 positive regulation of gene expression
GO:0010831 positive regulation of myotube differentiation
GO:0016310 phosphorylation
GO:0018105 peptidyl-serine phosphorylation
GO:0019395 fatty acid oxidation
GO:0030278 regulation of ossification
GO:0030316 osteoclast differentiation
GO:0031098 stress-activated protein kinase signaling cascade
GO:0031281 positive regulation of cyclase activity
GO:0031663 lipopolysaccharide-mediated signaling pathway
GO:0032495 response to muramyl dipeptide
GO:0032496 response to lipopolysaccharide
GO:0032735 positive regulation of interleukin-12 production
GO:0032868 response to insulin
GO:0035331 negative regulation of hippo signaling
GO:0035556 intracellular signal transduction
GO:0035924 cellular response to vascular endothelial growth factor stimulus
GO:0035994 response to muscle stretch
GO:0038066 p38MAPK cascade
GO:0042307 positive regulation of protein import into nucleus
GO:0042770 signal transduction in response to DNA damage
GO:0045648 positive regulation of erythrocyte differentiation
GO:0045663 positive regulation of myoblast differentiation
GO:0045944 positive regulation of transcription by RNA polymerase II
GO:0046323 D-glucose import
GO:0046326 positive regulation of D-glucose import
GO:0048010 vascular endothelial growth factor receptor signaling pathway
GO:0048863 stem cell differentiation
GO:0051146 striated muscle cell differentiation
GO:0051403 stress-activated MAPK cascade
GO:0060045 positive regulation of cardiac muscle cell proliferation
GO:0060348 bone development
GO:0071222 cellular response to lipopolysaccharide
GO:0071223 cellular response to lipoteichoic acid
GO:0071356 cellular response to tumor necrosis factor
GO:0071479 cellular response to ionizing radiation
GO:0071493 cellular response to UV-B
GO:0090090 negative regulation of canonical Wnt signaling pathway
GO:0090336 positive regulation of brown fat cell differentiation
GO:0090400 stress-induced premature senescence
GO:0098586 cellular response to virus
GO:0099179 regulation of synaptic membrane adhesion
GO:1900015 regulation of cytokine production involved in inflammatory response
GO:1901741 positive regulation of myoblast fusion
GO:2000379 positive regulation of reactive oxygen species metabolic process
Cellular Component
GO:0000922 spindle pole
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005829 cytosol
GO:0016607 nuclear speck
GO:0098978 glutamatergic synapse

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8acm, PDBe:8acm, PDBj:8acm
PDBsum8acm
PubMed
UniProtP47811|MK14_MOUSE Mitogen-activated protein kinase 14 (Gene Name=Mapk14)

[Back to BioLiP]