Structure of PDB 8pnc Chain A Binding Site BS03

Receptor Information
>8pnc Chain A (length=61) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PRKARTAFSDHQLNQLERSFERQKYLSVQDRMDLAAALNLTDTQVKTWYQ
NRRTKWKRQTA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8pnc Transcription factor BARHL2 bound to different DNA sequences
Resolution2.05 Å
Binding residue
(original residue number in PDB)		H242 N245 Q246
Binding residue
(residue number reindexed from 1)		H11 N14 Q15
External links
PDB RCSB:8pnc, PDBe:8pnc, PDBj:8pnc
PDBsum8pnc
PubMed
UniProtQ9NY43|BARH2_HUMAN BarH-like 2 homeobox protein (Gene Name=BARHL2)

[Back to BioLiP]