Structure of PDB 8pm7 Chain A Binding Site BS03

Receptor Information
>8pm7 Chain A (length=61) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KPRKARTAFSDHQLNQLERSFERQKYLSVQDRMDLAAALNLTDTQVKTWY
QNRRTKWKRQT
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8pm7 transcription factor BARHL2 bound to DNA sequences
Resolution1.7 Å
Binding residue
(original residue number in PDB)
T272 D273
Binding residue
(residue number reindexed from 1)
T42 D43
External links
PDB RCSB:8pm7, PDBe:8pm7, PDBj:8pm7
PDBsum8pm7
PubMed
UniProtQ9NY43|BARH2_HUMAN BarH-like 2 homeobox protein (Gene Name=BARHL2)

[Back to BioLiP]