Structure of PDB 8pk1 Chain A Binding Site BS03

Receptor Information
>8pk1 Chain A (length=107) Species: 1268061 (Streptococcus thermophilus DGCC 7710) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
YMRMILMFDMPTDTAEERKAYRKFRKFLLSEGFIMHQFSVYSKLLLNHTA
NTAMVGRLKANNPKKGNITILTVTEKQFARMIYLYGDKNTSIANSEERLV
FLGDNYC
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8pk1 Structural basis for spacer acquisition in a type II-A CRISPR-Cas system
Resolution3.17 Å
Binding residue
(original residue number in PDB)
H52 K80
Binding residue
(residue number reindexed from 1)
H48 K76
Gene Ontology
Molecular Function
GO:0004519 endonuclease activity
GO:0046872 metal ion binding
Biological Process
GO:0043571 maintenance of CRISPR repeat elements
GO:0051607 defense response to virus

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:8pk1, PDBe:8pk1, PDBj:8pk1
PDBsum8pk1
PubMed
UniProtG3ECR3|CAS2_STRTR CRISPR-associated endoribonuclease Cas2 (Gene Name=cas2)

[Back to BioLiP]