Structure of PDB 8kfu Chain A Binding Site BS03

Receptor Information
>8kfu Chain A (length=163) Species: 4577 (Zea mays) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GWVIGVDPDIGGAIAVLSPDGSSQVFDNPFVHIVVSEVIRKRLDTKSIIQ
LLRGLDAPPGTTAYIEKSSPFPTDGKQGWWSTGFSYGLWIASLVASGFSV
VPIASQTWKAYFGLMRSETPKDDSRQAASILFPDKDQSLKLKKHHGRAEA
LLLAAYGKGLVLP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8kfu MOC1 cleaves Holliday junctions through a cooperative nick and counter-nick mechanism mediated by metal ions.
Resolution2.3 Å
Binding residue
(original residue number in PDB)		D117 I118 R148 D182 Q185 G186 S189
Binding residue
(residue number reindexed from 1)		D9 I10 R40 D74 Q77 G78 S81
External links