Structure of PDB 8ka5 Chain A Binding Site BS03

Receptor Information

>8ka5 Chain A (length=297) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

QSEPWTVLAHKKPQKDWKAYNPKTMRPPPLPEGTKCVKVMTWNVNGLRGL
LKFESFSALQLAQRENFDILCLQETKLQVKDVEEIKKTLIDGYDHSFWSC
SVSKLGYSGTAIISRIKPLSVRYGTGLSGHDTEGRIVTAEFDSFYLINTY
VPNSGDGLKRLSYRIEEWDRTLSNHIKELEKSKPVVLTGDLNCAHEEIDI
FNPAGNKRSAGFTIEERQSFGANLLDKGFVDTFRKQHPGVVGYTYWGYRH
GGRKTNKGWRLDYFLVSQSIAANVHDSYILPDINGSDHCPIGLILKL

Ligand information

>8ka5 Chain D (length=20) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

gatccgtcgggcgcatcagc

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	8ka5 Arabidopsis AP endonuclease APR complex with 20bp THF-containing DNA
Resolution	2.8 Å
Binding residue (original residue number in PDB)	N284 G285 R287 G288 K315 Q317 L344 G345 Y487 R488
Binding residue (residue number reindexed from 1)	N45 G46 R48 G49 K76 Q78 L105 G106 Y248 R249

Enzymatic activity

Enzyme Commision number

3.1.11.2: exodeoxyribonuclease III.

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0003824	catalytic activity
GO:0004518	nuclease activity
GO:0004519	endonuclease activity

	Biological Process
GO:0006281	DNA repair

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:8ka5, PDBe:8ka5, PDBj:8ka5
PDBsum	8ka5
PubMed	38503293
UniProt	P45951\|ARP_ARATH DNA-(apurinic or apyrimidinic site) endonuclease, chloroplastic (Gene Name=ARP)

[Back to BioLiP]