Structure of PDB 8k29 Chain A Binding Site BS03

Receptor Information
>8k29 Chain A (length=174) Species: 979527 (Vibrio phage ICP1_2004_A) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MIKEMIEDFISKGGLIFTHSGRYTNTNNSCFIFNKNDIGVDTKVDMYTPK
SAGIKNEEGENLWQVLNKANMFYRIYSGELGEELQYLLKSCCTAKEDVTT
LPQIYFKNGEGYDILVPIGNAHNLISGTEYLWEHKYYNTFTQKLGGSNPQ
NCTHACNKMRGGFKQFNCTPPQVE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8k29 Structure of csy complex with long DNA State2
Resolution3.18 Å
Binding residue
(original residue number in PDB)		G53 W132 Y137 N138 T141 Q150 N157 K158 R160 G161 T169 P170 P171 V173 E174
Binding residue
(residue number reindexed from 1)		G53 W132 Y137 N138 T141 Q150 N157 K158 R160 G161 T169 P170 P171 V173 E174
External links