Structure of PDB 8k27 Chain A Binding Site BS03

Receptor Information
>8k27 Chain A (length=173) Species: 979527 (Vibrio phage ICP1_2004_A) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IKEMIEDFISKGGLIFTHSGRYTNTNNSCFIFNKNDIGVDTKVDMYTPKS
AGIKNEEGENLWQVLNKANMFYRIYSGELGEELQYLLKSCCTAKEDVTTL
PQIYFKNGEGYDILVPIGNAHNLISGTEYLWEHKYYNTFTQKLGGSNPQN
CTHACNKMRGGFKQFNCTPPQVE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8k27 Structure of csy complex with short DNA
Resolution3.6 Å
Binding residue
(original residue number in PDB)		K50 S51 W132 Y137 Q150 N157 K158 R160 G161
Binding residue
(residue number reindexed from 1)		K49 S50 W131 Y136 Q149 N156 K157 R159 G160
External links