Structure of PDB 8gn3 Chain A Binding Site BS03

Receptor Information
>8gn3 Chain A (length=57) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SLIMNKLKCPHCSYVAKYRRTLKRHLLIHTGVRSFSCDICGKLFTRREHV
KRHSLVH
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8gn3 Structural insights into ZBTB10 recognition of telomeric variant repeat TTGGGG
Resolution1.8 Å
Binding residue
(original residue number in PDB)		H726 H744
Binding residue
(residue number reindexed from 1)		H11 H29
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:8gn3, PDBe:8gn3, PDBj:8gn3
PDBsum8gn3
PubMed36657642
UniProtQ96DT7|ZBT10_HUMAN Zinc finger and BTB domain-containing protein 10 (Gene Name=ZBTB10)

[Back to BioLiP]