Structure of PDB 8elr Chain A Binding Site BS03

Receptor Information
>8elr Chain A (length=166) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGET
CLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYFEQI
KRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQ
GVEDAFYTLVREIRQH
Ligand information
Ligand IDMG
InChIInChI=1S/Mg/q+2
InChIKeyJLVVSXFLKOJNIY-UHFFFAOYSA-N
SMILES
SoftwareSMILES
ACDLabs 10.04
OpenEye OEToolkits 1.5.0		[Mg+2]
CACTVS 3.341[Mg++]
FormulaMg
NameMAGNESIUM ION
ChEMBL
DrugBankDB01378
ZINC
PDB chain8elr Chain A Residue 203 [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8elr Allosteric site variants affect GTP hydrolysis on Ras.
Resolution2.05 Å
Binding residue
(original residue number in PDB)		R102 D105
Binding residue
(residue number reindexed from 1)		R102 D105
Annotation score1
Enzymatic activity
Enzyme Commision number 3.6.5.2: small monomeric GTPase.
Gene Ontology
Molecular Function
GO:0003924 GTPase activity
GO:0003925 G protein activity
GO:0005515 protein binding
GO:0005525 GTP binding
GO:0016787 hydrolase activity
GO:0019003 GDP binding
GO:0043495 protein-membrane adaptor activity
GO:0160185 phospholipase C activator activity
Biological Process
GO:0000165 MAPK cascade
GO:0001934 positive regulation of protein phosphorylation
GO:0006357 regulation of transcription by RNA polymerase II
GO:0006897 endocytosis
GO:0006935 chemotaxis
GO:0007165 signal transduction
GO:0007166 cell surface receptor signaling pathway
GO:0007264 small GTPase-mediated signal transduction
GO:0007265 Ras protein signal transduction
GO:0008284 positive regulation of cell population proliferation
GO:0008285 negative regulation of cell population proliferation
GO:0008286 insulin receptor signaling pathway
GO:0009887 animal organ morphogenesis
GO:0010628 positive regulation of gene expression
GO:0010629 negative regulation of gene expression
GO:0014044 Schwann cell development
GO:0030335 positive regulation of cell migration
GO:0032729 positive regulation of type II interferon production
GO:0032956 regulation of actin cytoskeleton organization
GO:0034260 negative regulation of GTPase activity
GO:0042088 T-helper 1 type immune response
GO:0042127 regulation of cell population proliferation
GO:0042552 myelination
GO:0042832 defense response to protozoan
GO:0043406 positive regulation of MAP kinase activity
GO:0043410 positive regulation of MAPK cascade
GO:0043524 negative regulation of neuron apoptotic process
GO:0043547 positive regulation of GTPase activity
GO:0045944 positive regulation of transcription by RNA polymerase II
GO:0046330 positive regulation of JNK cascade
GO:0048144 fibroblast proliferation
GO:0048146 positive regulation of fibroblast proliferation
GO:0048169 regulation of long-term neuronal synaptic plasticity
GO:0050679 positive regulation of epithelial cell proliferation
GO:0050852 T cell receptor signaling pathway
GO:0051402 neuron apoptotic process
GO:0051726 regulation of cell cycle
GO:0060612 adipose tissue development
GO:0070374 positive regulation of ERK1 and ERK2 cascade
GO:0071480 cellular response to gamma radiation
GO:0090303 positive regulation of wound healing
GO:0090314 positive regulation of protein targeting to membrane
GO:0090398 cellular senescence
GO:0090402 oncogene-induced cell senescence
GO:0097193 intrinsic apoptotic signaling pathway
GO:0098696 regulation of neurotransmitter receptor localization to postsynaptic specialization membrane
GO:1900029 positive regulation of ruffle assembly
GO:2000630 positive regulation of miRNA metabolic process
Cellular Component
GO:0000139 Golgi membrane
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005737 cytoplasm
GO:0005789 endoplasmic reticulum membrane
GO:0005794 Golgi apparatus
GO:0005829 cytosol
GO:0005886 plasma membrane
GO:0016020 membrane
GO:0048471 perinuclear region of cytoplasm
GO:0098978 glutamatergic synapse
GO:1905360 GTPase complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8elr, PDBe:8elr, PDBj:8elr
PDBsum8elr
PubMed37615343
UniProtP01112|RASH_HUMAN GTPase HRas (Gene Name=HRAS)

[Back to BioLiP]