Structure of PDB 8bv1 Chain A Binding Site BS03

Receptor Information

>8bv1 Chain A (length=155) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

MAKVQVNNVVVLDNPSPFYNPFQFEITFECIEDLSEDLEWKIIYVGSAES
EEYDQVLDSVLVGPVPAGRHMFVFQADAPNPGLIPDADAVGVTVVLITCT
YRGQEFIRVGYYVNNEYTETELRENPPVKPDFSKLQRNILASNPRVTRFH
INWED

Ligand information

>8bv1 Chain L (length=11) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

EKIARLARRIA

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	8bv1 Unexpected binding modes of inhibitors to the histone chaperone ASF1 revealed by a foldamer scanning approach.
Resolution	2.834 Å
Binding residue (original residue number in PDB)	S35 E36 D37 P64 P66
Binding residue (residue number reindexed from 1)	S35 E36 D37 P64 P66

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Biological Process
GO:0006325	chromatin organization

	Cellular Component
GO:0005634	nucleus

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8bv1, PDBe:8bv1, PDBj:8bv1
PDBsum	8bv1
PubMed	37347155
UniProt	Q9Y294\|ASF1A_HUMAN Histone chaperone ASF1A (Gene Name=ASF1A)

[Back to BioLiP]