Structure of PDB 7zyg Chain A Binding Site BS03

Receptor Information
>7zyg Chain A (length=505) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GRDSLIFLVDASKAMFESQSEDELTPFDMSIQCIQSVYISKIISSDRDLL
AVVFYGTEKDKNSVNFKNIYVLQELDNPGAKRILELDQFKGQQGQKRFQD
MMGHGSDYSLSEVLWVCANLFSDVQFKMSHKRIMLFTNEDNPHGNDSAKA
SRARTKAGDLRDTGIFLDLMHLKKPGGFDISLFYRDIISIAEDEDLRVHF
EESSKLEDLLRKVRAKETRKRALSRLKLKLNKDIVISVGIYNLVQKALKP
PPIKLYRETNEPVKTKTRTFNTSTGGLLLPSDTKRSQIYGSRQIILEKEE
TEELKRFDDPGLMLMGFKPLVLLKKHHYLRPSLFVYPEESLVIGSSTLFS
ALLIKCLEKEVAALCRYTPRRNIPPYFVALVPQEEELDDQKIQVTPPGFQ
LVFLPFADDKRKMPFTEKIMATPEQVGKMKAIVEKLRFTYRSDSFENPVL
QQHFRNLEALALDLMEPEQAVDLTLPKVEAMNKRLGSLVDEFKELVYPPD
YNPEG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7zyg PAXX binding to the NHEJ machinery explains functional redundancy with XLF.
Resolution2.68 Å
Binding residue
(original residue number in PDB)		R254 A255 R258 T300 R403 R404 R444
Binding residue
(residue number reindexed from 1)		R221 A222 R225 T267 R370 R371 R411
Enzymatic activity
Enzyme Commision number 3.6.4.-
4.2.99.-
Gene Ontology
Molecular Function
GO:0000976 transcription cis-regulatory region binding
GO:0003677 DNA binding
GO:0003678 DNA helicase activity
GO:0003684 damaged DNA binding
GO:0003690 double-stranded DNA binding
GO:0003691 double-stranded telomeric DNA binding
GO:0003723 RNA binding
GO:0004386 helicase activity
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0008094 ATP-dependent activity, acting on DNA
GO:0016787 hydrolase activity
GO:0016829 lyase activity
GO:0016887 ATP hydrolysis activity
GO:0030332 cyclin binding
GO:0042162 telomeric DNA binding
GO:0044877 protein-containing complex binding
GO:0045027 DNA end binding
GO:0051575 5'-deoxyribose-5-phosphate lyase activity
GO:0097110 scaffold protein binding
Biological Process
GO:0000723 telomere maintenance
GO:0000725 recombinational repair
GO:0002218 activation of innate immune response
GO:0006266 DNA ligation
GO:0006281 DNA repair
GO:0006303 double-strand break repair via nonhomologous end joining
GO:0006310 DNA recombination
GO:0010558 negative regulation of macromolecule biosynthetic process
GO:0032508 DNA duplex unwinding
GO:0045087 innate immune response
GO:0045621 positive regulation of lymphocyte differentiation
GO:0045860 positive regulation of protein kinase activity
GO:0045892 negative regulation of DNA-templated transcription
GO:0045893 positive regulation of DNA-templated transcription
GO:0045944 positive regulation of transcription by RNA polymerase II
GO:0048660 regulation of smooth muscle cell proliferation
GO:0071475 cellular hyperosmotic salinity response
GO:0071480 cellular response to gamma radiation
GO:0071481 cellular response to X-ray
GO:0097680 double-strand break repair via classical nonhomologous end joining
Cellular Component
GO:0000781 chromosome, telomeric region
GO:0000783 nuclear telomere cap complex
GO:0005576 extracellular region
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005667 transcription regulator complex
GO:0005694 chromosome
GO:0005730 nucleolus
GO:0005829 cytosol
GO:0005958 DNA-dependent protein kinase-DNA ligase 4 complex
GO:0016020 membrane
GO:0032991 protein-containing complex
GO:0032993 protein-DNA complex
GO:0034774 secretory granule lumen
GO:0043564 Ku70:Ku80 complex
GO:0070418 DNA-dependent protein kinase complex
GO:0070419 nonhomologous end joining complex
GO:1904813 ficolin-1-rich granule lumen

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7zyg, PDBe:7zyg, PDBj:7zyg
PDBsum7zyg
PubMed37256950
UniProtP12956|XRCC6_HUMAN X-ray repair cross-complementing protein 6 (Gene Name=XRCC6)

[Back to BioLiP]