Structure of PDB 7zgo Chain A Binding Site BS03

Receptor Information
>7zgo Chain A (length=470) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KFGWIKGVLVRCMLNIWGVMLFIRLSWIVGQAGIGLSVLVIMMATVVTTI
TGLSTSAIATNGFVRGGGAYYLISRSLGPEFGGAIGLIFAFANAVAVAMY
VVGFAETVVELLKEHSILMIDEINDIRIIGAITVVILLGISVAGMEWEAK
AQIVLLVILLLAIGDFVIGTFIPLESKKPKGFFGYKSEIFNENFGPDFRE
EETFFSVFAIFFPAATGILAGANISGDLADPQSAIPKGTLLAILITTLVY
VGIAVSVGSCVVRDATGNVNDTIVTELTNCTSAACKLNFDFSSCESSPCS
YGLMNNFQVMSMVSGFTPLISAGIFSATLSSALASLVSAPKIFQALCKDN
IYPAFQMFAKGYGKNNEPLRGYILTFLIALGFILIAELNVIAPIISNFFL
ASYALINFSVFHASLAKSPGWRPAFKYYNMWISLLGAILCCIVMFVINWW
AALLTYVIVLGLYIYVTYKK
Ligand information
Ligand IDCL
InChIInChI=1S/ClH/h1H/p-1
InChIKeyVEXZGXHMUGYJMC-UHFFFAOYSA-M
SMILES
SoftwareSMILES
ACDLabs 10.04
CACTVS 3.341
OpenEye OEToolkits 1.5.0		[Cl-]
FormulaCl
NameCHLORIDE ION
ChEMBL
DrugBankDB14547
ZINC
PDB chain7zgo Chain A Residue 1303 [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7zgo Cryo-EM structure of the human NKCC1 transporter reveals mechanisms of ion coupling and specificity.
Resolution2.55 Å
Binding residue
(original residue number in PDB)		G301 V302 M303 P496 A497
Binding residue
(residue number reindexed from 1)		G18 V19 M20 P213 A214
Annotation score5
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0008511 sodium:potassium:chloride symporter activity
GO:0008519 ammonium channel activity
GO:0015079 potassium ion transmembrane transporter activity
GO:0015293 symporter activity
GO:0015377 chloride:monoatomic cation symporter activity
GO:0019901 protein kinase binding
GO:0022857 transmembrane transporter activity
GO:0046873 metal ion transmembrane transporter activity
GO:0051087 protein-folding chaperone binding
GO:0051879 Hsp90 protein binding
Biological Process
GO:0006811 monoatomic ion transport
GO:0006813 potassium ion transport
GO:0006814 sodium ion transport
GO:0006821 chloride transport
GO:0006883 intracellular sodium ion homeostasis
GO:0006884 cell volume homeostasis
GO:0006972 hyperosmotic response
GO:0007214 gamma-aminobutyric acid signaling pathway
GO:0010818 T cell chemotaxis
GO:0030007 intracellular potassium ion homeostasis
GO:0030321 transepithelial chloride transport
GO:0030644 intracellular chloride ion homeostasis
GO:0035633 maintenance of blood-brain barrier
GO:0035725 sodium ion transmembrane transport
GO:0035865 cellular response to potassium ion
GO:0045795 positive regulation of cell volume
GO:0055064 chloride ion homeostasis
GO:0055075 potassium ion homeostasis
GO:0055078 sodium ion homeostasis
GO:0055085 transmembrane transport
GO:0061044 negative regulation of vascular wound healing
GO:0070634 transepithelial ammonium transport
GO:0072488 ammonium transmembrane transport
GO:0098658 inorganic anion import across plasma membrane
GO:0098659 inorganic cation import across plasma membrane
GO:0098719 sodium ion import across plasma membrane
GO:0150003 regulation of spontaneous synaptic transmission
GO:0150104 transport across blood-brain barrier
GO:1902476 chloride transmembrane transport
GO:1904450 positive regulation of aspartate secretion
GO:1904464 regulation of matrix metallopeptidase secretion
GO:1990573 potassium ion import across plasma membrane
GO:1990869 cellular response to chemokine
Cellular Component
GO:0005886 plasma membrane
GO:0009925 basal plasma membrane
GO:0016020 membrane
GO:0016323 basolateral plasma membrane
GO:0016324 apical plasma membrane
GO:0016328 lateral plasma membrane
GO:0030659 cytoplasmic vesicle membrane
GO:0031253 cell projection membrane
GO:0042995 cell projection
GO:0043005 neuron projection
GO:0043025 neuronal cell body
GO:0044297 cell body
GO:0044298 cell body membrane
GO:0070062 extracellular exosome
GO:0071944 cell periphery
GO:1903561 extracellular vesicle

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7zgo, PDBe:7zgo, PDBj:7zgo
PDBsum7zgo
PubMed36239040
UniProtP55011|S12A2_HUMAN Solute carrier family 12 member 2 (Gene Name=SLC12A2)

[Back to BioLiP]