Structure of PDB 7wwv Chain A Binding Site BS03

Receptor Information
>7wwv Chain A (length=179) Species: 1296592 (Vibrio phage ICP1_2011_A) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MIKEMIEDFISKGGLIFTHSGRYTNTNNSCFIFNKNDIGVDTKVDMYTPK
SAGIKNEEGENLWQVLNKANMFYRIYSGELGEELQYLLKSCCTAKEDVTT
LPQIYFKNGEGYDILVPIGNAHNLISGTEYLWEHKYYNTFTQKLGGSNPQ
NCTHACNKMRGGFKQFNCTPPQVEDNYNA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7wwv Mechanistic insights into DNA binding and cleavage by a compact type I-F CRISPR-Cas system in bacteriophage.
Resolution3.2 Å
Binding residue
(original residue number in PDB)
A52 K55 W132 Y137 Q150 K158 R160
Binding residue
(residue number reindexed from 1)
A52 K55 W132 Y137 Q150 K158 R160
Enzymatic activity
Enzyme Commision number ?
External links