Structure of PDB 7tfk Chain A Binding Site BS03

Receptor Information
>7tfk Chain A (length=360) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
REEDKLWTVKYAPTNLQQVCGNKGSVMKLKNWLANWENSKKNSFKHAGKD
GSGVFRAAMLYGPPGIGKTTAAHLVAQELGYDILEQNANGKHFVIIMDEV
DGMGVGQLAQFCRKTSTPLILICNERNLPKMRPFDRVCLDIQFRRPDANS
IKSRLMTIAIREKFKLDPNVIDRLIQTTRGDIRQVINLLSTISTTTKTIN
HENINEISKAWEKNIALKPFDIAHKMLDGQIYSDIGSRNFTLNDKIALYF
DDFDFTPLMIQENYLSTRPSVLKPGQSHLEAVAEAANCISLGDIVEKKIR
SSEQLWSLLPLHAVLSSVYPASKVAGHMAGRINFTAWLGQNSKSAKYYRL
LQEIHYHTRL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7tfk Cryo-EM structures reveal that RFC recognizes both the 3'- and 5'-DNA ends to load PCNA onto gaps for DNA repair.
Resolution3.25 Å
Binding residue
(original residue number in PDB)
N459 Q474 R476 R477 F552 R663
Binding residue
(residue number reindexed from 1)
N127 Q142 R144 R145 F220 R331
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003689 DNA clamp loader activity
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0016887 ATP hydrolysis activity
Biological Process
GO:0000278 mitotic cell cycle
GO:0006260 DNA replication
GO:0006261 DNA-templated DNA replication
GO:0006271 DNA strand elongation involved in DNA replication
GO:0006272 leading strand elongation
GO:0006281 DNA repair
GO:0006298 mismatch repair
GO:0051301 cell division
Cellular Component
GO:0005634 nucleus
GO:0005663 DNA replication factor C complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:7tfk, PDBe:7tfk, PDBj:7tfk
PDBsum7tfk
PubMed35829698
UniProtP38630|RFC1_YEAST Replication factor C subunit 1 (Gene Name=RFC1)

[Back to BioLiP]