Structure of PDB 6wid Chain A Binding Site BS03

Receptor Information
>6wid Chain A (length=330) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PAWMPAYACQRPTPLTHHNTGLSEALEILAEAAGFEGSEGRLLTFCRAAS
VLKALPSPVTTLSQLQGLPHFGEHSSRVVQELLEHGVCEEVERVRRSERY
QTMKLFTQIFGVGVKTADRWYREGLRTLDDLREQPQKLTQQQKAGLQHHQ
DLSTPVLRSDVDALQQVVEEAVGQALPGATVTLTGGFRRGKLQGHDVDFL
ITHPKEGQEAGLLPRVMCRLQDQGLILYHQHAFERSFCIFRLPQPGSWKA
VRVDLVVAPVSQFPFALLGWTGSKLFQRELRRFSRKEKGLWLNSHGLFDP
EQKTFFQAASEEDIFRHLGLEYLPPEQRNA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6wid Structural snapshots of human DNA polymerase mu engaged on a DNA double-strand break.
Resolution1.5 Å
Binding residue
(original residue number in PDB)		G245 V246 G247 K249 T250 H329 D330 D332 F389 R416 D418 G433 W434 T435 G436 K438
Binding residue
(residue number reindexed from 1)		G111 V112 G113 K115 T116 H195 D196 D198 F237 R252 D254 G269 W270 T271 G272 K274
Enzymatic activity
Catalytic site (original residue number in PDB) D330 D332 D418
Catalytic site (residue number reindexed from 1) D196 D198 D254
Enzyme Commision number 2.7.7.7: DNA-directed DNA polymerase.
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003887 DNA-directed DNA polymerase activity
GO:0016779 nucleotidyltransferase activity
GO:0034061 DNA polymerase activity
Biological Process
GO:0006281 DNA repair
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6wid, PDBe:6wid, PDBj:6wid
PDBsum6wid
PubMed32963245
UniProtQ9NP87|DPOLM_HUMAN DNA-directed DNA/RNA polymerase mu (Gene Name=POLM)

[Back to BioLiP]