Structure of PDB 6nid Chain A Binding Site BS03

Receptor Information
>6nid Chain A (length=86) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RVRLVQFQKNTDEPMGITLKMNELNHCIVARIMHGGMIHRQGTLHVGDEI
REINGISVANQTVEQLQKMLREMRGSITFKIVPSYR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6nid CASK PDZ domain specificity
Resolution1.86 Å
Binding residue
(original residue number in PDB)
Q492 K566
Binding residue
(residue number reindexed from 1)
Q6 K80
Enzymatic activity
Enzyme Commision number 2.7.11.1: non-specific serine/threonine protein kinase.
External links
PDB RCSB:6nid, PDBe:6nid, PDBj:6nid
PDBsum6nid
PubMed
UniProtO14936|CSKP_HUMAN Peripheral plasma membrane protein CASK (Gene Name=CASK)

[Back to BioLiP]