Structure of PDB 6kal Chain A Binding Site BS03

Receptor Information
>6kal Chain A (length=443) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GPRVTVLVREFEAFDNAVPELVDSFLQQDPAQPVVVAADTLPYPPLALPR
IPNVRLALLQPALDRPAAASRPETYVATEFVALVPDGARAEAPGLLERMV
EALRAGSARLVAAPVATANPARCLALNVSLREWTARYGAAPAAPRCDALD
GDAVVLLRARDLFNLSAPLARPVGTSLFLQTALRGWAVQLLDLTFAAARQ
PPLATAHARWKAEREGRARRAALLRALGIRLVSWEGGRLEWFGCNKETTR
CFGTVVGDTPAYLYEERWTPPCCLRALRETARYVVGVLEAAGVRYWLEGG
SLLGAARHGDIIPWDYDVDLGIYLEDVGNCEQLRGAEAGSVVDERGFVWE
KAVEGDFFRVQYSESNHLHVDLWPFYPRNGVMTKDTWQDVEFPEHFLQPL
VPLPFAGFVAQAPNNYRRFLELKFGPGVIENPQYPNPALLSLT
Ligand information
Ligand IDMG
InChIInChI=1S/Mg/q+2
InChIKeyJLVVSXFLKOJNIY-UHFFFAOYSA-N
SMILES
SoftwareSMILES
ACDLabs 10.04
OpenEye OEToolkits 1.5.0		[Mg+2]
CACTVS 3.341[Mg++]
FormulaMg
NameMAGNESIUM ION
ChEMBL
DrugBankDB01378
ZINC
PDB chain6kal Chain A Residue 504 [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6kal Crystal structures of fukutin-related protein (FKRP), a ribitol-phosphate transferase related to muscular dystrophy.
Resolution2.6 Å
Binding residue
(original residue number in PDB)		D362 D364
Binding residue
(residue number reindexed from 1)		D317 D319
Annotation score1
Enzymatic activity
Enzyme Commision number 2.7.8.-
Gene Ontology
Molecular Function
GO:0002162 dystroglycan binding
GO:0005515 protein binding
GO:0016740 transferase activity
GO:0016780 phosphotransferase activity, for other substituted phosphate groups
GO:0042802 identical protein binding
GO:0043236 laminin binding
GO:0046872 metal ion binding
Biological Process
GO:0001654 eye development
GO:0001701 in utero embryonic development
GO:0001764 neuron migration
GO:0003007 heart morphogenesis
GO:0003016 respiratory system process
GO:0006096 glycolytic process
GO:0006486 protein glycosylation
GO:0006600 creatine metabolic process
GO:0006629 lipid metabolic process
GO:0006936 muscle contraction
GO:0006954 inflammatory response
GO:0007417 central nervous system development
GO:0007420 brain development
GO:0007507 heart development
GO:0007519 skeletal muscle tissue development
GO:0007628 adult walking behavior
GO:0008104 protein localization
GO:0009100 glycoprotein metabolic process
GO:0009101 glycoprotein biosynthetic process
GO:0009410 response to xenobiotic stimulus
GO:0010001 glial cell differentiation
GO:0010467 gene expression
GO:0014823 response to activity
GO:0016485 protein processing
GO:0017038 protein import
GO:0019321 pentose metabolic process
GO:0019519 pentitol metabolic process
GO:0030198 extracellular matrix organization
GO:0030282 bone mineralization
GO:0035269 protein O-linked mannosylation
GO:0035437 maintenance of protein localization in endoplasmic reticulum
GO:0036058 filtration diaphragm assembly
GO:0036211 protein modification process
GO:0038026 reelin-mediated signaling pathway
GO:0042692 muscle cell differentiation
GO:0043010 camera-type eye development
GO:0043403 skeletal muscle tissue regeneration
GO:0043491 phosphatidylinositol 3-kinase/protein kinase B signal transduction
GO:0050905 neuromuscular process
GO:0051146 striated muscle cell differentiation
GO:0051262 protein tetramerization
GO:0051384 response to glucocorticoid
GO:0051674 localization of cell
GO:0060538 skeletal muscle organ development
GO:0060539 diaphragm development
GO:0061061 muscle structure development
GO:0061448 connective tissue development
GO:0071711 basement membrane organization
GO:0072592 oxygen metabolic process
GO:0097305 response to alcohol
GO:0097709 connective tissue replacement
GO:0098528 skeletal muscle fiber differentiation
Cellular Component
GO:0000139 Golgi membrane
GO:0005576 extracellular region
GO:0005615 extracellular space
GO:0005654 nucleoplasm
GO:0005737 cytoplasm
GO:0005783 endoplasmic reticulum
GO:0005791 rough endoplasmic reticulum
GO:0005794 Golgi apparatus
GO:0005829 cytosol
GO:0005886 plasma membrane
GO:0042383 sarcolemma
GO:0098723 skeletal muscle myofibril

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6kal, PDBe:6kal, PDBj:6kal
PDBsum6kal
PubMed31949166
UniProtQ9H9S5|FKRP_HUMAN Ribitol 5-phosphate transferase FKRP (Gene Name=FKRP)

[Back to BioLiP]