Structure of PDB 6een Chain A Binding Site BS03

Receptor Information
>6een Chain A (length=315) Species: 4577 (Zea mays) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VVTYTTLIDGLAKAGRLEEALQLFQEMKEKGVKPDVVTYTTLIDGLAKAG
RLEEALQLFQEMKEKGVKPDVVTYTTLIDGLAKAGRLEEALQLFQEMKEK
GVKPDVVTYTTLIDGLAKAGRLEEALQLFQEMKEKGVKPDVVTYTTLIDG
LAKAGRLEEALQLFEEMKEKGVKPDVVTYTTLIDGLAKAGRLEEALQLFQ
EMKEKGVKPDVVTYTTLIDGLAKAGRLEEALQLFEEMKEKGVKPDVVTYT
TLIDGLAKAGRLEEALQLFEEMKEKGVKPDVVTYTTLIDGLAKAGRLEEA
LQLFQEMKEKGVKPD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6een Crystal structure of a designer Pentatrico Peptide RNA binding protein, bound to a complex RNA target and featuring an infinite superhelix and microheterogeneity.
Resolution2.01 Å
Binding residue
(original residue number in PDB)		V6 T9 T10 D13 K17 D39 V41 T44 T45 D48 K52 D74 V76 T79 T80 D83 K87 D109 V111 T114 T115 D118 K122 D144 V146 T149 T150 D153 K157 D179 V181 T184 T185 D188 K192 D214 V216 T219 T220 D223 K227 D249 V251 T254 T255 D258 D284 V286 T289 T290 D319
Binding residue
(residue number reindexed from 1)		V2 T5 T6 D9 K13 D35 V37 T40 T41 D44 K48 D70 V72 T75 T76 D79 K83 D105 V107 T110 T111 D114 K118 D140 V142 T145 T146 D149 K153 D175 V177 T180 T181 D184 K188 D210 V212 T215 T216 D219 K223 D245 V247 T250 T251 D254 D280 V282 T285 T286 D315
External links