Structure of PDB 5yeh Chain A Binding Site BS03

Receptor Information
>5yeh Chain A (length=139) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KPFKCSMCDYASVEVSKLKRHIRSHTGERPFQCSLCSYASRDTYKLKRHM
RTHSGEKPYECYICHARFTQSGTMKMHILQKHTENVAKFHCPHCDTVIAR
KSDLGVHLRKQHSYIEQGKKCRYCDAVFHERYALIQHQK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5yeh Molecular mechanism of directional CTCF recognition of a diverse range of genomic sites
Resolution2.328 Å
Binding residue
(original residue number in PDB)
H441 C442
Binding residue
(residue number reindexed from 1)
H93 C94
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5yeh, PDBe:5yeh, PDBj:5yeh
PDBsum5yeh
PubMed29076501
UniProtP49711|CTCF_HUMAN Transcriptional repressor CTCF (Gene Name=CTCF)

[Back to BioLiP]