Structure of PDB 5vvl Chain A Binding Site BS03

Receptor Information

>5vvl Chain A (length=264) Species: 83333 (Escherichia coli K-12)

SMIFLQYGQIDVIDGAFVLIDKTGIRTHIPVGSVACIMLEPGTRVSHAAV
RLAAQVGTLLVWVGEAGVRVYASGQPGGARSDKLLYQAKLALDEDLRLKV
VRKMFELRFGEPAPARRSVEQLRGIEGSRVRATYALLAKQYGVTWNGRRY
DPWEKGDTINQCISAATSCLYGVTEAAILAAGYAPAIGFVHTGKPLSFVY
DIADIIKFDTVVPKAFEIARRNPGEPDREVRLACRDIFRSSKTLAKLIPL
IEDVLAAGEIQPPA

Ligand information

>5vvl Chain K (length=34)

gctactggggccgagggtgttccgagcagtgctc

Receptor-Ligand Complex Structure

Structure summary

• PDB: 5vvl Structures of the CRISPR genome integration complex.
• Resolution: 3.31 Å
• Binding residue (original residue number in PDB): E135 Q136 R138 G139 E141 G142 S143 V145 R146 W160 G162
• Binding residue (residue number reindexed from 1): E120 Q121 R123 G124 E126 G127 S128 V130 R131 W145 G147

Enzymatic activity

• Enzyme Commision number: 3.1.-.-

Gene Ontology

Molecular Function

• GO:0003676 nucleic acid binding
• GO:0003677 DNA binding
• GO:0004519 endonuclease activity
• GO:0004520 DNA endonuclease activity
• GO:0005515 protein binding
• GO:0008821 crossover junction DNA endonuclease activity
• GO:0017108 5'-flap endonuclease activity
• GO:0042802 identical protein binding
• GO:0042803 protein homodimerization activity
• GO:0046872 metal ion binding

Biological Process

• GO:0006281 DNA repair
• GO:0006974 DNA damage response
• GO:0043571 maintenance of CRISPR repeat elements
• GO:0051607 defense response to virus
• GO:0099048 CRISPR-cas system

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:5vvl, PDBe:5vvl, PDBj:5vvl
• PDBsum: 5vvl
• PubMed: 28729350
• UniProt: Q46896|CAS1_ECOLI CRISPR-associated endonuclease Cas1 (Gene Name=ygbT)