Structure of PDB 5vvk Chain A Binding Site BS03

Receptor Information
>5vvk Chain A (length=266) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SMIFLQYGQIDVIDGAFVLIDKTGIRTHIPVGSVACIMLEPGTRVSHAAV
RLAAQVGTLLVWVGEAGVRVYASGQPGGARSDKLLYQAKLALDEDLRLKV
VRKMFELRFGEPAPARRSVEQLRGIEGSRVRATYALLAKQYGVTWNGRRY
DPKDWEKGDTINQCISAATSCLYGVTEAAILAAGYAPAIGFVHTGKPLSF
VYDIADIIKFDTVVPKAFEIARRNPGEPDREVRLACRDIFRSSKTLAKLI
PLIEDVLAAGEIQPPA
Ligand information
>5vvk Chain K (length=43) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gctactggggccgagggtgttcctaaaccgagcagatatgctc
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5vvk Structures of the CRISPR genome integration complex.
Resolution2.9 Å
Binding residue
(original residue number in PDB)		E135 Q136 R138 G139 I140 G142 S143 V145 R146 Y149 W160 G162
Binding residue
(residue number reindexed from 1)		E120 Q121 R123 G124 I125 G127 S128 V130 R131 Y134 W145 G147
Enzymatic activity
Enzyme Commision number 3.1.-.-
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003677 DNA binding
GO:0004519 endonuclease activity
GO:0004520 DNA endonuclease activity
GO:0005515 protein binding
GO:0008821 crossover junction DNA endonuclease activity
GO:0017108 5'-flap endonuclease activity
GO:0042802 identical protein binding
GO:0042803 protein homodimerization activity
GO:0046872 metal ion binding
Biological Process
GO:0006281 DNA repair
GO:0006974 DNA damage response
GO:0043571 maintenance of CRISPR repeat elements
GO:0051607 defense response to virus
GO:0099048 CRISPR-cas system
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5vvk, PDBe:5vvk, PDBj:5vvk
PDBsum5vvk
PubMed28729350
UniProtQ46896|CAS1_ECOLI CRISPR-associated endonuclease Cas1 (Gene Name=ygbT)

[Back to BioLiP]