Structure of PDB 5m5v Chain A Binding Site BS03

Receptor Information

>5m5v Chain A (length=360) Species: 9913 (Bos taurus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

ILPIRFQEHLQLQNLGINPANIGFSTLTMESDKFICIREKVGEQAQVVII
DMNDPSNPIRRPISADSAIMNPASKVIALKAGKTLQIFNIEMKSKMKAHT
MTDDVTFWKWISLNTVALVTDNAVYHWSMEGESQPVKMFDRHSSLAGCQI
INYRTDAKQKWLLLTGISAQQNRVVGAMQLYSVDRKVSQPIEGHAASFAQ
FKMEGNAEESTLFCFAVRGQAGGKLHIIEVGTPPTGNQPFPKKAVDVFFP
PEAQNDFPVAMQISEKHDVVFLITKYGYIHLYDLETGTCIYMNRISGETI
FVTAPHEATAGIIGVNRKGQVLSVCVEEENIIPYITNVLQNPDLALRMAV
RNNLAGAEEL

Ligand information

>5m5v Chain I (length=4) Species: 12475 (Hepatitis delta virus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

LPLL

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5m5v Cellular and viral peptides bind multiple sites on the N-terminal domain of clathrin.
Resolution	1.96 Å
Binding residue (original residue number in PDB)	L183 Q192 F216
Binding residue (residue number reindexed from 1)	L180 Q189 F213

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0005198	structural molecule activity

	Biological Process
GO:0006886	intracellular protein transport
GO:0016192	vesicle-mediated transport

	Cellular Component
GO:0030130	clathrin coat of trans-Golgi network vesicle
GO:0030132	clathrin coat of coated pit

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5m5v, PDBe:5m5v, PDBj:5m5v
PDBsum	5m5v
PubMed	27813245
UniProt	P49951\|CLH1_BOVIN Clathrin heavy chain 1 (Gene Name=CLTC)

[Back to BioLiP]