Structure of PDB 5m0j Chain A Binding Site BS03

Receptor Information

>5m0j Chain A (length=223) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

DIKVTPGTSELVEQILALLSRYLSSYIHVLNKFISHLRRVATLRFERTTL
IKFVKKLRFYNDSVLSYNASEFINADSFDKVILPIASMFVKSVETFDLLN
YYLTQSLQKEILSKTLNEDLTLTAESILAIDDTYNHFVKFSQWMIESLRI
GSNLLDLEVVQFAIKSADEDGDNIFLQEILPVNSEEEFQTLSAAWHSILD
GKLSALDEEFDVVATKWHDKFGK

Ligand information

>5m0j Chain F (length=28) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

gauaacugaaucgaaagacauuaucacg

<<<<......<<....>>...>>>>...

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5m0j Molecular architecture and dynamics of ASH1 mRNA recognition by its mRNA-transport complex.
Resolution	2.8 Å
Binding residue (original residue number in PDB)	S40 R43 R52 I56 K60 R63
Binding residue (residue number reindexed from 1)	S35 R38 R47 I51 K55 R58

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003729	mRNA binding
GO:0005515	protein binding
GO:0008289	lipid binding
GO:1990825	sequence-specific mRNA binding

	Biological Process
GO:0007533	mating type switching
GO:0008298	intracellular mRNA localization
GO:0051028	mRNA transport

	Cellular Component
GO:0005634	nucleus
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005934	cellular bud tip

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5m0j, PDBe:5m0j, PDBj:5m0j
PDBsum	5m0j
PubMed	28092367
UniProt	P36068\|SHE2_YEAST SWI5-dependent HO expression protein 2 (Gene Name=SHE2); P38272\|SHE3_YEAST SWI5-dependent HO expression protein 3 (Gene Name=SHE3)

[Back to BioLiP]